Description
Overview
Long Name |
Antibody Type |
Antibody Isotype |
Host |
Species Reactivity |
Validated Applications |
Purification |
| heat shock 70kDa protein 2 | Polyclonal | IgG | Rabbit | Human, Mouse, Rat | IHC-P, WB | Immunogen affinity purified. |
Immunogen |
||||||
| A synthetic peptide corresponding to a sequence at the C-terminus of human HSPA2 (564-598aa KISEQDKNKILDKCQEVINWLDRNQMAEKDEYEHK), identical to the related mouse and rat sequences. | ||||||
Properties
Form |
Lyophilized |
Size |
100 µg/vial |
Contents |
Antibody is lyophilized with 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg NaN3. *carrier free antibody available upon request. |
Concentration |
Reconstitute with 0.2 mL sterile dH2O (500 µg/ml final concentration). |
Storage |
At -20 °C for 12 months, as supplied. Store reconstituted antibody at 2-8 °C for one month. For long-term storage, aliquot and store at -20 °C. Avoid repeated freezing and thawing. |
Additional Information Regarding the Antigen
Gene |
HSPA2 |
Protein |
Heat shock-related 70 kDa protein 2 |
Uniprot ID |
P54652 |
Function |
|
Tissue Specificity |
|
Sub-cellular localization |
|
Sequence Similarities |
|
Aliases |
70kDa antibody|DAQB 147D11.1 001 antibody|Hcp70.2 antibody|Heat shock 70 kDa protein 2 antibody|heat shock 70kDa protein 1A antibody| Heat shock protein 2 antibody|heat shock protein 70 antibody|Heat shock protein 70.2 antibody|Heat shock related 70 kDa protein 2 antibody| Heat shock-related 70 kDa protein 2 antibody|Heat-shock protein, 70-KD, 2 antibody|Heat-shock protein, 70-KD, 3 antibody| HSP70 2 antibody| HSP70 3 antibody|Hsp70-2 antibody|HSP70-3 antibody|HSP70.2 antibody|HSP70A2 antibody|HSP72 antibody|HSP72_HUMAN antibody|HSPA2 antibody|Hspt70 antibody|Hst70 antibody|MGC58299 antibody|MGC7795 antibody|MGC93458 antibody|OTTHUMP00000180664 antibody| Testis-specific heat shock protein-related antibody|XXbac BCX40G17.3 001 antibody |
Application Details
Anti- HSPA2 antibody, ASA-B0927, Western blotting
All lanes: Anti HSPA2 (ASA-B0927) at 0.5ug/ml
Lane 1: Rat Liver Tissue Lysate at 50ug
Lane 2: Rat Thymus Tissue Lysate at 50ug
Lane 3: Rat Testis Tissue Lysate at 50ug
Lane 4: Mouse Liver Tissue Lysate at 50ug
Lane 5: Mouse Kidney Tissue Lysate at 50ug
Lane 6: HELA Whole Cell Lysate at 40ug
Lane 7: MCF-7 Whole Cell Lysate at 40ug
Lane 8: A375 Whole Cell Lysate at 40ug
Lane 9: NIH3T3 Whole Cell Lysa
All lanes: Anti HSPA2 (ASA-B0927) at 0.5ug/ml
Lane 1: Rat Liver Tissue Lysate at 50ug
Lane 2: Rat Thymus Tissue Lysate at 50ug
Lane 3: Rat Testis Tissue Lysate at 50ug
Lane 4: Mouse Liver Tissue Lysate at 50ug
Lane 5: Mouse Kidney Tissue Lysate at 50ug
Lane 6: HELA Whole Cell Lysate at 40ug
Lane 7: MCF-7 Whole Cell Lysate at 40ug
Lane 8: A375 Whole Cell Lysate at 40ug
Lane 9: NIH3T3 Whole Cell Lysa
Anti- HSPA2 antibody, ASA-B0927,IHC(P)
IHC(P): Mouse Intestine Tissue
IHC(P): Mouse Intestine Tissue
Anti- HSPA2 antibody, ASA-B0927,IHC(P)
IHC(P): Rat Intestine Tissue
IHC(P): Rat Intestine Tissue
