Description
Overview
Long Name |
Antibody Type |
Antibody Isotype |
Host |
Species Reactivity |
Validated Applications |
Purification |
| indoleamine 2,3-dioxygenase 1 | Polyclonal | IgG | Rabbit | Human, Mouse, Rat | IHC-P, WB | Immunogen affinity purified. |
Immunogen |
||||||
| A synthetic peptide corresponding to a sequence at the N-terminus of human IDO1 (37-69aa NDWMFIAKHLPDLIESGQLRERVEKLNMLSIDH), different from the related mouse sequence by fourteen amino acids, and from the related rat sequence by seventeen amino acids. | ||||||
Properties
Form |
Lyophilized |
Size |
100 µg/vial |
Contents |
Antibody is lyophilized with 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg NaN3. *carrier free antibody available upon request. |
Concentration |
Reconstitute with 0.2 mL sterile dH2O (500 µg/ml final concentration). |
Storage |
At -20 °C for 12 months, as supplied. Store reconstituted antibody at 2-8 °C for one month. For long-term storage, aliquot and store at -20 °C. Avoid repeated freezing and thawing. |
Additional Information Regarding the Antigen
Gene |
IDO1 |
Protein |
Indoleamine 2,3-dioxygenase 1 |
Uniprot ID |
P14902 |
Function |
Catalyzes the cleavage of the pyrrol ring of tryptophan and incorporates both atoms of a molecule of oxygen. |
Tissue Specificity |
|
Sub-cellular localization |
|
Sequence Similarities |
Belongs to the indoleamine 2,3-dioxygenase family. |
Aliases |
3-dioxygenase antibody|I23O1_HUMAN antibody|IDO 1 antibody|IDO antibody|IDO-1 antibody|IDO1 antibody|INDO antibody|indolamine 2,3 dioxygenase antibody|Indole 2 3 dioxygenase antibody|indoleamine 2 3 dioxygenase 1 antibody|indoleamine 2 3 dioxygenase antibody| Indoleamine 2,3-dioxygenase 1 antibody|Indoleamine pyrrole 2 3 dioxygenase antibody|Indoleamine-pyrrole 2 antibody |
Application Details
| Application | Concentration* | Species | Validated Using** |
| Western blot | 0.1-0.5μg/ml | Human, Mouse, Rat | AssaySolutio’s ECL kit |
| Immunohistochemistry(Paraffin-embedded Section) | 0.5-1μg/ml | Human | AssaySolutio’s IHC/ICC Detection kit |
AssaySolution recommends Rabbit Chemiluminescent WB Detection Kit (AKIT001B) for Western blot, and Rabbit Peroxidase IHC/ICC Detection Kit (AKIT002B) for IHC(P). *Blocking peptide can be purchased at $65. Contact us for more information

Anti- IDO1 antibody, ASA-B0968, Western blotting
All lanes: Anti IDO1 (ASA-B0968) at 0.5ug/ml
Lane 1: Rat Lung Tissue Lysate at 50ug
Lane 2: Rat Spleen Tissue Lysate at 50ug
Lane 3: Human Placenta Tissue Lysate at 50ug
Lane 4: A549 Whole Cell Lysate at 40ug
Lane 5: SW620 Whole Cell Lysate at 40ug
Lane 6: NIH3T3 Whole Cell Lysate at 40ug
Predicted bind size: 45KD
Observed bind size: 45KD
All lanes: Anti IDO1 (ASA-B0968) at 0.5ug/ml
Lane 1: Rat Lung Tissue Lysate at 50ug
Lane 2: Rat Spleen Tissue Lysate at 50ug
Lane 3: Human Placenta Tissue Lysate at 50ug
Lane 4: A549 Whole Cell Lysate at 40ug
Lane 5: SW620 Whole Cell Lysate at 40ug
Lane 6: NIH3T3 Whole Cell Lysate at 40ug
Predicted bind size: 45KD
Observed bind size: 45KD

Anti- IDO1 antibody, ASA-B0968, IHC(P)
IHC(P): Human Lung Cancer Tissue
IHC(P): Human Lung Cancer Tissue





