Interleukin-19 Mouse Recombinant ( IL 19 Mouse )

Price range: $192.50 through $5,045.04

Novatein Biosciences provides Interleukin-19 Mouse Recombinant ( IL 19 Mouse ) also known as IL-10C, IL-19, MDA1, NG.1, ZMDA1, Melanoma differentiation association like protein for your R&D

SKU: PT_41164 Category:

Description

Data Sheet

Amino acid sequence MLRRCLISVDMRLIEKSFHEIKRAMQTKDTFKNVTILSLENLRSIKPGDVCCMTNNLLTFYRDRVFQDHQERSLEVLRRISSIANSFLCVQKSLERCQVHRQCNCSQEATNATRIIHDNYNQLEVSSAALKSLGELNILLAWIDRNHLETPAA.
Description Interleukin-19 Mouse Recombinant produced in E.Coli is a single, non-glycosylated polypeptide chain containing 153 amino acids and having a molecular mass of 17.7kDa. The IL-19 is purified by proprietary chromatographic techniques.
Expression host Escherichia Coli.
Formulation Lyophilized from a sterile filtered aqueous solution containing 5mM Na3PO4 and 150mM NaCl, pH 7.5.
Protein Background IL19 is a cytokine that belongs to the IL10 cytokine subfamily. IL-19 is found to be preferentially expressed in monocytes. It can bind the IL20 receptor complex and lead to the activation of the signal transducer and activator of transcription 3 (STAT3). A similar cytokine in mouse is reported to up-regulate the expression of IL6 and TNF-alpha and induce apoptosis, which suggests a role of this cytokine in inflammatory responses. Alternatively spliced transcript variants encoding the distinct isoforms have been described.
Purity Greater than 95.0% as determined by SDS-PAGE.
Reagent Appearance Sterile Filtered White lyophilized (freeze-dried) powder.
Solubility It is recommended to reconstitute the lyophilized IL-19 in sterile 18M-cm H2O not less than 100ug/ml, which can then be further diluted to other aqueous solutions.
Stability Lyophilized Interleukin-19 although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution IL19 should be stored at 4°C between 2-7 days and for future use below -18°C.For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA).Please prevent freeze-thaw cycles.
Synonyms Interleukin-19, IL-19, Il19.

Additional information

Size

2ug, 10ug, 1mg