Description
Data Sheet
| Amino acid sequence | VPPGEDSKDVAAPHRQPLTSSERIDKQIRYILDGISALRKETCNKSNMCESSKEALAENNLNLPKMAEKDGCFQSGFNEETCLVKIITGLLEFEVYLEYLQNRFESSEEQARAVQMSTKVLIQFLQKKAKNLDAITTPDPTTNASLLTKLQAQNQWLQDMTTHLILRSFKEFLQSSLRALRQM |
| Biological Activity | ED50 |
| Description | Interleukin-6 Human Recombinant produced in CHO is a 21-23kDa single, glycosylated polypeptide chain containing 183 amino acids. |
| Expression host | Chinese Hamster Ovarian Cells. |
| Formulation | IL-6 is a sterile filtered (0.22um) solution (0.22mg/ml) in 20mM Tris-HCl buffer pH 7.2. |
| Protein Background | IL-6 is a cytokine with a wide variety of biological functions: it plays an essential role in the final differentiation of b-cells into ig-secreting cells, it induces myeloma and plasmacytoma growth, it induces nerve cells differentiation, in hepatocytes it induces acute phase reactants. |
| Purity | Greater than 95.0% as determined by analysis by SDS-PAGE. |
| Reagent Appearance | Sterile filtered colorless solution. |
| Stability | Store at 4°C if entire vial will be used within 2-4 weeks. Store, frozen at -20°C for longer periods of time. For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA).Avoid multiple freeze-thaw cycles. |
| Synonyms | IFN-b2, B cell differentiation factor, BCDF, BSF-2, HPGF, HSF, MGI-2, B-cell stimulatory factor 2, Interferon beta-2, Hybridoma growth factor, CTL differentiation factor, CDF, IL-6, HGF. |

