Description
Overview
Long Name |
Antibody Type |
Antibody Isotype |
Host |
Species Reactivity |
Validated Applications |
Purification |
| interferon regulatory factor 5 | Polyclonal | IgG | Rabbit | Human, Mouse, Rat | IHC-P, WB | Immunogen affinity purified. |
Immunogen |
||||||
| A synthetic peptide corresponding to a sequence at the C-terminus of human IRF5 (442-472aa RLQISNPDLKDRMVEQFKELHHIWQSQQRLQ), different from the related mouse sequence by three amino acids. | ||||||
Properties
Form |
Lyophilized |
Size |
100 µg/vial |
Contents |
Antibody is lyophilized with 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg NaN3. *carrier free antibody available upon request. |
Concentration |
Reconstitute with 0.2 mL sterile dH2O (500 µg/ml final concentration). |
Storage |
At -20 °C for 12 months, as supplied. Store reconstituted antibody at 2-8 °C for one month. For long-term storage, aliquot and store at -20 °C. Avoid repeated freezing and thawing. |
Additional Information Regarding the Antigen
Gene |
IRF5 |
Protein |
Interferon regulatory factor 5 |
Uniprot ID |
Q13568 |
Function |
|
Tissue Specificity |
|
Sub-cellular localization |
|
Sequence Similarities |
|
Aliases |
Interferon regulatory factor 5 antibody|Interferon regulatory factor 5 bone marrow variant antibody|IRF 5 antibody|IRF-5 antibody|Irf5 antibody| IRF5_HUMAN antibody|SLEB10 antibody |
Application Details
Anti- IRF5 antibody, ASA-B1071, Western blotting
All lanes: Anti IRF5 (ASA-B1071) at 0.5ug/ml
Lane 1: Rat Intestine Tissue Lysate at 50ug
Lane 2: HELA Whole Cell Lysate at 40ug
Lane 3: COLO320 Whole Cell Lysate at 40ug
Lane 4: NIH3T3 Whole Cell Lysate at 40ug
Lane 5: HEPA Whole Cell Lysate at 40ug
Predicted bind size: 56KD
Observed bind size: 56KD
All lanes: Anti IRF5 (ASA-B1071) at 0.5ug/ml
Lane 1: Rat Intestine Tissue Lysate at 50ug
Lane 2: HELA Whole Cell Lysate at 40ug
Lane 3: COLO320 Whole Cell Lysate at 40ug
Lane 4: NIH3T3 Whole Cell Lysate at 40ug
Lane 5: HEPA Whole Cell Lysate at 40ug
Predicted bind size: 56KD
Observed bind size: 56KD
Anti- IRF5 antibody, ASA-B1071, IHC(P)
IHC(P): Mouse Spleen Tissue
IHC(P): Mouse Spleen Tissue
Anti- IRF5 antibody, ASA-B1071, IHC(P)
IHC(P): Rat Spleen Tissue
IHC(P): Rat Spleen Tissue
