Description
Overview
Long Name |
Antibody Type |
Antibody Isotype |
Host |
Species Reactivity |
Validated Applications |
Purification |
| integrin, alpha 2b (platelet glycoprotein IIb of IIb/IIIa complex, antigen CD41) | Polyclonal | IgG | Rabbit | Human, Mouse, Rat | IHC-P, WB | Immunogen affinity purified. |
Immunogen |
||||||
| A synthetic peptide corresponding to a sequence at the C-terminus of human ITGA2B (677-711aa EAELAVHLPQGAHYMRALSNVEGFERLICNQKKEN), different from the related mouse sequence by four amino acids. | ||||||
Properties
Form |
Lyophilized |
Size |
100 µg/vial |
Contents |
Antibody is lyophilized with 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg NaN3. *carrier free antibody available upon request. |
Concentration |
Reconstitute with 0.2 mL sterile dH2O (500 µg/ml final concentration). |
Storage |
At -20 °C for 12 months, as supplied. Store reconstituted antibody at 2-8 °C for one month. For long-term storage, aliquot and store at -20 °C. Avoid repeated freezing and thawing. |
Additional Information Regarding the Antigen
Gene |
ITGA2B |
Protein |
Integrin alpha-Iib |
Uniprot ID |
P08514 |
Function |
|
Tissue Specificity |
|
Sub-cellular localization |
|
Sequence Similarities |
|
Aliases |
antigen CD41 antibody|BDPLT16 antibody|BDPLT2 antibody|CD41 antibody|CD41B antibody|form 2 antibody|GP2B antibody|GPalpha IIb antibody|GPIIb antibody|GT antibody|GTA antibody|HPA3 antibody|Integrin alpha 2b antibody|Integrin alpha IIb antibody|Integrin alpha-IIb light chain antibody|Integrin, alpha 2b (platelet glycoprotein IIb of IIb/IIIa complex, antigen CD41) antibody|ITA2B_HUMAN antibody|ITGA2B antibody| ITGAB antibody|platelet fibrinogen receptor, alpha subunit antibody|platelet glycoprotein IIb of IIb/IIIa complex antibody|Platelet membrane glycoprotein IIb antibody|platelet specific antigen BAK antibody |
Application Details
Anti- ITGA2B antibody, ASA-B1077, Western blotting
All lanes: Anti ITGA2B (ASA-B1077) at 0.5ug/ml
Lane 1: Rat Lung Tissue Lysate at 50ug
Lane 2: Rat Liver Tissue Lysate at 50ug
Lane 3: Mouse Spleen Tissue Lysate at 50ug
Predicted bind size: 113KD
Observed bind size: 113KD
All lanes: Anti ITGA2B (ASA-B1077) at 0.5ug/ml
Lane 1: Rat Lung Tissue Lysate at 50ug
Lane 2: Rat Liver Tissue Lysate at 50ug
Lane 3: Mouse Spleen Tissue Lysate at 50ug
Predicted bind size: 113KD
Observed bind size: 113KD
Anti- ITGA2B antibody, ASA-B1077, IHC(P)
IHC(P): Mouse Lung Tissue
IHC(P): Mouse Lung Tissue
Anti- ITGA2B antibody, ASA-B1077, IHC(P)
IHC(P): Rat Lung Tissue
IHC(P): Rat Lung Tissue
