Description
Overview
Long Name |
Antibody Type |
Antibody Isotype |
Host |
Species Reactivity |
Validated Applications |
Purification |
| Kv channel interacting protein 2 | Polyclonal | IgG | Rabbit | Human, Mouse, Rat | IHC-P, WB | Immunogen affinity purified. |
Immunogen |
||||||
| A synthetic peptide corresponding to a sequence at the N-terminus of human KChIP2 (78-112aa DEFELSTVCHRPEGLEQLQEQTKFTRKELQVLYR), different from the related mouse and rat sequences by one amino acid. | ||||||
Properties
Form |
Lyophilized |
Size |
100 µg/vial |
Contents |
Antibody is lyophilized with 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg NaN3. *carrier free antibody available upon request. |
Concentration |
Reconstitute with 0.2 mL sterile dH2O (500 µg/ml final concentration). |
Storage |
At -20 °C for 12 months, as supplied. Store reconstituted antibody at 2-8 °C for one month. For long-term storage, aliquot and store at -20 °C. Avoid repeated freezing and thawing. |
Additional Information Regarding the Antigen
Gene |
KCNIP2 |
Protein |
Kv channel-interacting protein 2 |
Uniprot ID |
Q9NS61 |
Function |
|
Tissue Specificity |
|
Sub-cellular localization |
|
Sequence Similarities |
|
Aliases |
A type potassium channel modulatory protein 2 antibody|A-type potassium channel modulatory protein 2 antibody|Cardiac voltage gated potassium channel modulatory subunit antibody|Cardiac voltage-gated potassium channel modulatory subunit antibody|DKFZp566L1246 antibody|KChIP 2 antibody|KChIP2 antibody|KCIP2_HUMAN antibody|KCNIP 2 antibody|Kcnip2 antibody|Kv channel interacting protein 2 antibody|Kv channel-interacting protein 2 antibody|MGC17241 antibody|Potassium channel interacting protein 2 antibody|Potassium channel-interacting protein 2 antibody |
Application Details
Anti- KCNIP2 antibody, ASA-B1104, Western blotting
All lanes: Anti KCNIP2 (ASA-B1104) at 0.5ug/ml
Lane 1: Rat Brain Tissue Lysate at 50ug
Lane 2: Rat Cardiac Muscle Tissue Lysate at 50ug
Lane 3: Mouse Cardiac Muscle Tissue Lysate at 50ug
Lane 4: 22RV1 Whole Cell Lysate at 40ug
Predicted bind size: 31KD
Observed bind size: 31KD
All lanes: Anti KCNIP2 (ASA-B1104) at 0.5ug/ml
Lane 1: Rat Brain Tissue Lysate at 50ug
Lane 2: Rat Cardiac Muscle Tissue Lysate at 50ug
Lane 3: Mouse Cardiac Muscle Tissue Lysate at 50ug
Lane 4: 22RV1 Whole Cell Lysate at 40ug
Predicted bind size: 31KD
Observed bind size: 31KD
Anti- KCNIP2 antibody, ASA-B1104,IHC(P)
IHC(P): Mouse Brain Tissue
IHC(P): Mouse Brain Tissue
Anti- KCNIP2 antibody, ASA-B1104,IHC(P)
IHC(P): Human Glioma Tissue
IHC(P): Human Glioma Tissue
