Description
Overview
Long Name |
Antibody Type |
Antibody Isotype |
Host |
Species Reactivity |
Validated Applications |
Purification |
| autophagy related 13 | Polyclonal | IgG | Rabbit | Human, Mouse | WB | Immunogen affinity purified. |
Immunogen |
||||||
| A synthetic peptide corresponding to a sequence at the C-terminus of human KIAA0652 (488-517aa MAEDLDSLPEKLAVHEKNVREFDAFVETLQ), identical to the related mouse sequence. | ||||||
Properties
Form |
Lyophilized |
Size |
100 µg/vial |
Contents |
Antibody is lyophilized with 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg NaN3. *carrier free antibody available upon request. |
Concentration |
Reconstitute with 0.2 mL sterile dH2O (500 µg/ml final concentration). |
Storage |
At -20 °C for 12 months, as supplied. Store reconstituted antibody at 2-8 °C for one month. For long-term storage, aliquot and store at -20 °C. Avoid repeated freezing and thawing. |
Additional Information Regarding the Antigen
Gene |
ATG13 |
Protein |
Autophagy-related protein 13 |
Uniprot ID |
O75143 |
Function |
Autophagy factor required for autophagosome formation and mitophagy. Target of the TOR kinase signaling pathway that regulates autophagy through the control of the phosphorylation status of ATG13 and ULK1, and the regulation of the ATG13-ULK1- RB1CC1 complex. Through its regulation of ULK1 activity, plays a role in the regulation of the kinase activity of mTORC1 and cell proliferation. |
Tissue Specificity |
|
Sub-cellular localization |
Cytoplasm, cytosol . Preautophagosomal structure . Note: Under starvation conditions, is localized to puncate structures primarily representing the isolation membrane; the isolation membrane sequesters a portion of the cytoplasm resulting in autophagosome formation. |
Sequence Similarities |
Belongs to the ATG13 metazoan family. |
Aliases |
ATG13 antibody|ATG13 autophagy related 13 homolog (S. cerevisiae) antibody| ATG13_HUMAN antibody|Autophagy related 13 antibody|Autophagy related protein 13 antibody|Autophagy-related protein 13 antibody|FLJ20698 antibody| KIAA0652 antibody|OTTHUMP00000233321 antibody|OTTHUMP00000233322 antibody|OTTHUMP00000233323 antibody|OTTHUMP00000233324 antibody| OTTHUMP00000233325 antibody|OTTHUMP00000233326 antibody |
Application Details
| Application | Concentration* | Species | Validated Using** |
| Western blot | 0.1-0.5μg/ml | Human, Mouse | AssaySolutio’s ECL kit |
AssaySolution recommends Rabbit Chemiluminescent WB Detection Kit (AKIT001B) for Western blot. *Blocking peptide can be purchased at $65. Contact us for more information

Anti- KIAA0652 antibody, ASA-B1120, Western blotting
All lanes: Anti KIAA0652 (ASA-B1120) at 0.5ug/ml
Lane 1: HELA Whole Cell Lysate at 40ug
Lane 2: HEPA Whole Cell Lysate at 40ug
Predicted bind size: 56KD
Observed bind size: 56KD
All lanes: Anti KIAA0652 (ASA-B1120) at 0.5ug/ml
Lane 1: HELA Whole Cell Lysate at 40ug
Lane 2: HEPA Whole Cell Lysate at 40ug
Predicted bind size: 56KD
Observed bind size: 56KD





