Description
Overview
Long Name |
Antibody Type |
Antibody Isotype |
Host |
Species Reactivity |
Validated Applications |
Purification |
| potassium channel, voltage gated shaker related subfamily A, member 2 | Polyclonal | IgG | Rabbit | Human, Mouse, Rat | WB | Immunogen affinity purified. |
Immunogen |
||||||
| A synthetic peptide corresponding to a sequence at the C-terminus of human Kv1.2 (466-499aa NNSNEDFREENLKTANCTLANTNYVNITKMLTDV), identical to the related mouse and rat sequences. | ||||||
Properties
Form |
Lyophilized |
Size |
100 µg/vial |
Contents |
Antibody is lyophilized with 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg NaN3. *carrier free antibody available upon request. |
Concentration |
Reconstitute with 0.2 mL sterile dH2O (500 µg/ml final concentration). |
Storage |
At -20 °C for 12 months, as supplied. Store reconstituted antibody at 2-8 °C for one month. For long-term storage, aliquot and store at -20 °C. Avoid repeated freezing and thawing. |
Additional Information Regarding the Antigen
Gene |
KCNA2 |
Protein |
Potassium voltage-gated channel subfamily A member 2 |
Uniprot ID |
P16389 |
Function |
|
Tissue Specificity |
|
Sub-cellular localization |
|
Sequence Similarities |
|
Aliases |
Akr6a4 antibody|BK2 antibody|HBK5 antibody|HK4 antibody|HUKIV antibody|Kca1 2 antibody|kcna2 antibody|KV1.2 antibody|MGC50217 antibody|Mk 2 antibody|MK2 antibody|NGK1 antibody|Potassium voltage gated channel shaker related subfamily member 2 antibody|Potassium voltage-gated channel subfamily A member 2 antibody|RBK2 antibody|Voltage gated potassium channel subunit Kv1.2 antibody |
Application Details

Anti- Kv1.2 antibody, ASA-B1140, Western blotting
All lanes: Anti Kv1.2 (ASA-B1140) at 0.5ug/ml
Lane 1: Rat Kidney Tissue Lysate at 50ug
Lane 2: Rat Brain Tissue Lysate at 50ug
Lane 3: Mouse Brain Tissue Lysate at 50ug
Lane 4: Mouse Kidney Tissue Lysate at 50ug
Predicted bind size: 57KD
Observed bind size: 57KD
All lanes: Anti Kv1.2 (ASA-B1140) at 0.5ug/ml
Lane 1: Rat Kidney Tissue Lysate at 50ug
Lane 2: Rat Brain Tissue Lysate at 50ug
Lane 3: Mouse Brain Tissue Lysate at 50ug
Lane 4: Mouse Kidney Tissue Lysate at 50ug
Predicted bind size: 57KD
Observed bind size: 57KD





