Description
Overview
Long Name |
Antibody Type |
Antibody Isotype |
Host |
Species Reactivity |
Validated Applications |
Purification |
| leukemia inhibitory factor receptor alpha | Polyclonal | IgG | Rabbit | Human | WB | Immunogen affinity purified. |
Immunogen |
||||||
| A synthetic peptide corresponding to a sequence at the C-terminus of human LIFR(863-899aa EWIKETFYPDIPNPENCKALQFQKSVCEGSSALKTLE), different from the related mouse and rat sequences by one amino acid. | ||||||
Properties
Form |
Lyophilized |
Size |
100 µg/vial |
Contents |
Antibody is lyophilized with 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg NaN3. *carrier free antibody available upon request. |
Concentration |
Reconstitute with 0.2 mL sterile dH2O (500 µg/ml final concentration). |
Storage |
At -20 °C for 12 months, as supplied. Store reconstituted antibody at 2-8 °C for one month. For long-term storage, aliquot and store at -20 °C. Avoid repeated freezing and thawing. |
Additional Information Regarding the Antigen
Gene |
LIFR |
Protein |
Leukemia inhibitory factor receptor |
Uniprot ID |
P42702 |
Function |
|
Tissue Specificity |
|
Sub-cellular localization |
|
Sequence Similarities |
|
Aliases |
CD118 antibody|CD118 antigen antibody|FLJ98106 antibody|FLJ99923 antibody|Leukemia inhibitory factor receptor alpha antibody|Leukemia inhibitory factor receptor antibody|LIF R antibody|LIF receptor antibody|LIF-R antibody|Lifr antibody|LIFR_HUMAN antibody|SJS2 antibody|STWS antibody|SWS antibody |
Application Details
Anti- LIFR antibody, ASA-B1170, Western blotting
All lanes: Anti LIFR (ASA-B1170) at 0.5ug/ml
Lane 1: SW620 Whole Cell Lysate at 40ug
Lane 2: COLO320 Whole Cell Lysate at 40ug
Lane 3: HEPG2 Whole Cell Lysate at 40ug
Predicted bind size: 190KD
Observed bind size: 190KD
All lanes: Anti LIFR (ASA-B1170) at 0.5ug/ml
Lane 1: SW620 Whole Cell Lysate at 40ug
Lane 2: COLO320 Whole Cell Lysate at 40ug
Lane 3: HEPG2 Whole Cell Lysate at 40ug
Predicted bind size: 190KD
Observed bind size: 190KD
