Description
Overview
Long Name |
Antibody Type |
Antibody Isotype |
Host |
Species Reactivity |
Validated Applications |
Purification |
| fatty acid binding protein 1, liver | Polyclonal | IgG | Rabbit | Human, Mouse, Rat | IHC-P, WB | Immunogen affinity purified. |
Immunogen |
||||||
| A synthetic peptide corresponding to a sequence at the N-terminus of human liver FABP (6-36aa KYQLQSQENFEAFMKAIGLPEELIQKGKDIK), different from the related mouse sequence by two amino acids, and from the related rat sequence by four amino acids. | ||||||
Properties
Form |
Lyophilized |
Size |
100 µg/vial |
Contents |
Antibody is lyophilized with 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg NaN3. *carrier free antibody available upon request. |
Concentration |
Reconstitute with 0.2 mL sterile dH2O (500 µg/ml final concentration). |
Storage |
At -20 °C for 12 months, as supplied. Store reconstituted antibody at 2-8 °C for one month. For long-term storage, aliquot and store at -20 °C. Avoid repeated freezing and thawing. |
Additional Information Regarding the Antigen
Gene |
FABP1 |
Protein |
Fatty acid-binding protein, liver |
Uniprot ID |
P07148 |
Function |
Binds free fatty acids and their coenzyme A derivatives, bilirubin, and some other small molecules in the cytoplasm. May be involved in intracellular lipid transport. |
Tissue Specificity |
|
Sub-cellular localization |
Cytoplasm. |
Sequence Similarities |
|
Aliases |
FABP 1 antibody|FABP1 antibody|FABP-1 antibody|FABPL antibody|FABPL_HUMAN antibody|Fatty Acid Binding Protein 1 antibody|Fatty acid binding protein 1 liver antibody|Fatty Acid Binding Protein antibody|Fatty acid-binding protein 1 antibody|Fatty acid-binding protein antibody|Fatty acid-binding protein liver antibody|L FABP antibody|L-FABP antibody|liver antibody|Liver-type fatty acid-binding protein antibody |
Application Details
| Application | Concentration* | Species | Validated Using** |
| Western blot | 0.1-0.5μg/ml | Human, Mouse, Rat | AssaySolutio’s ECL kit |
| Immunohistochemistry(Paraffin-embedded Section) | 0.5-1μg/ml | Human, Mouse, Rat | AssaySolutio’s IHC/ICC Detection kit |
AssaySolution recommends Rabbit Chemiluminescent WB Detection Kit (AKIT001B) for Western blot, and Rabbit Peroxidase IHC/ICC Detection Kit (AKIT002B) for IHC(P). *Blocking peptide can be purchased at $65. Contact us for more information

Anti- liver FABP antibody, ASA-B1180, Western blotting
All lanes: Anti liver FABP (ASA-B1180) at 0.5ug/ml
Lane 1: Rat Liver Tissue Lysate at 50ug
Lane 2: Mouse Liver Tissue Lysate at 50ug
Lane 3: SMMC Whole Cell Lysate at 40ug
Lane 4: HEPG2 Whole Cell Lysate at 40ug
Lane 5: RH35 Whole Cell Lysate at 40ug
Predicted bind size: 14KD
Observed bind size: 14KD
All lanes: Anti liver FABP (ASA-B1180) at 0.5ug/ml
Lane 1: Rat Liver Tissue Lysate at 50ug
Lane 2: Mouse Liver Tissue Lysate at 50ug
Lane 3: SMMC Whole Cell Lysate at 40ug
Lane 4: HEPG2 Whole Cell Lysate at 40ug
Lane 5: RH35 Whole Cell Lysate at 40ug
Predicted bind size: 14KD
Observed bind size: 14KD

Anti- liver FABP antibody, ASA-B1180,IHC(P)
IHC(P): Mouse Intestine Tissue
IHC(P): Mouse Intestine Tissue

Anti- liver FABP antibody, ASA-B1180,IHC(P)
IHC(P): Rat Intestine Tissue
IHC(P): Rat Intestine Tissue




