Description
Overview
Long Name |
Antibody Type |
Antibody Isotype |
Host |
Species Reactivity |
Validated Applications |
Purification |
| lysozyme | Polyclonal | IgG | Rabbit | Human, Rat | IHC-P, WB | Immunogen affinity purified. |
Immunogen |
||||||
| A synthetic peptide corresponding to a sequence at the C-terminus of human Lysozyme (106-141aa NIADAVACAKRVVRDPQGIRAWVAWRNRCQNRDVRQ). | ||||||
Properties
Form |
Lyophilized |
Size |
100 µg/vial |
Contents |
Antibody is lyophilized with 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg NaN3. *carrier free antibody available upon request. |
Concentration |
Reconstitute with 0.2 mL sterile dH2O (500 µg/ml final concentration). |
Storage |
At -20 °C for 12 months, as supplied. Store reconstituted antibody at 2-8 °C for one month. For long-term storage, aliquot and store at -20 °C. Avoid repeated freezing and thawing. |
Additional Information Regarding the Antigen
Gene |
LYZ |
Protein |
Lysozyme C |
Uniprot ID |
P61626 |
Function |
|
Tissue Specificity |
|
Sub-cellular localization |
|
Sequence Similarities |
|
Aliases |
1 4 beta n acetylmuramidase c antibody|1 antibody|4-beta-N-acetylmuramidase C antibody|EC 3.2.1.17 antibody|LYSC_HUMAN antibody| Lysosyme antibody|Lysozyme (renal amyloidosis) antibody|Lysozyme C antibody|Lysozyme C precursor antibody|Lyz antibody|LZM antibody| Renal amyloidosis antibody |
Application Details
Anti- Lysozyme antibody, ASA-B1202, Western blotting
All lanes: Anti Lysozyme (ASA-B1202) at 0.5ug/ml
Lane 1: Rat Intestine Tissue Lysate at 50ug
Lane 2: Rat Kidney Tissue Lysate at 50ug
Lane 3: Rat Liver Tissue Lysate at 50ug
Lane 4: HELA Whole Cell Lysate at 40ug
Lane 5: SW620 Whole Cell Lysate at 40ug
Lane 6: 293T Whole Cell Lysate at 40ug
Lane 7: HEPG2 Whole Cell Lysate at 40ug
Predicted bind size: 17KD
Observed bind size: 17KD
All lanes: Anti Lysozyme (ASA-B1202) at 0.5ug/ml
Lane 1: Rat Intestine Tissue Lysate at 50ug
Lane 2: Rat Kidney Tissue Lysate at 50ug
Lane 3: Rat Liver Tissue Lysate at 50ug
Lane 4: HELA Whole Cell Lysate at 40ug
Lane 5: SW620 Whole Cell Lysate at 40ug
Lane 6: 293T Whole Cell Lysate at 40ug
Lane 7: HEPG2 Whole Cell Lysate at 40ug
Predicted bind size: 17KD
Observed bind size: 17KD
Anti- Lysozyme antibody, ASA-B1202, IHC(P)
IHC(P): Human Intestinal Cancer Tissue
IHC(P): Human Intestinal Cancer Tissue
