Description
Overview
Long Name |
Antibody Type |
Antibody Isotype |
Host |
Species Reactivity |
Validated Applications |
Purification |
| monoamine oxidase B | Polyclonal | IgG | Rabbit | Human, Mouse, Rat | IHC-P, WB | Immunogen affinity purified. |
Immunogen |
||||||
| A synthetic peptide corresponding to a sequence at the C-terminus of human MAOB (448-484aa REILHAMGKIPEDEIWQSEPESVDVPAQPITTTFLER), different from the related mouse sequence by five amino acids, and from the related rat sequence by four amino acids. | ||||||
Properties
Form |
Lyophilized |
Size |
100 µg/vial |
Contents |
Antibody is lyophilized with 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg NaN3. *carrier free antibody available upon request. |
Concentration |
Reconstitute with 0.2 mL sterile dH2O (500 µg/ml final concentration). |
Storage |
At -20 °C for 12 months, as supplied. Store reconstituted antibody at 2-8 °C for one month. For long-term storage, aliquot and store at -20 °C. Avoid repeated freezing and thawing. |
Additional Information Regarding the Antigen
Gene |
MAOB |
Protein |
Amine oxidase [flavin-containing] B |
Uniprot ID |
P21397 |
Function |
|
Tissue Specificity |
|
Sub-cellular localization |
|
Sequence Similarities |
|
Aliases |
Adrenalin oxidase antibody|Amine oxidase (flavin containing) antibody|Amine oxidase [flavin-containing] B antibody|AOFB_HUMAN antibody| HGNC:6834 antibody|MAO, brain antibody| MAO, platelet antibody|MAO-B antibody|MAOB antibody|MGC26382 antibody|Monoamine oxidase B antibody|Monoamine oxidase type B antibody|OTTHUMP00000023166 antibody|RP1 201D17__B.1 antibody|Tyramine oxidase antibody |
Application Details
Anti- MAOB antibody, ASA-B1214, Western blotting
All lanes: Anti MAOB (ASA-B1214) at 0.5ug/ml
Lane 1: Rat Cardiac MuscleTissue Lysate at 50ug
Lane 2: Rat Kidney Tissue Lysate at 50ug
Lane 3: Rat Intestine Tissue Lysate at 50ug
Lane 4: Mouse Kidney Tissue Lysate at 50ug
Lane 5: Mouse Intestine Tissue Lysate at 50ug
Lane 6: Mouse Cardiac Muscle Tissue Lysate at 50ug
Lane 7: HEPG2 Whole Cell Lysate at 40ug
Lane 8: HELA Whole Cell Lysate at 40ug
Lane
All lanes: Anti MAOB (ASA-B1214) at 0.5ug/ml
Lane 1: Rat Cardiac MuscleTissue Lysate at 50ug
Lane 2: Rat Kidney Tissue Lysate at 50ug
Lane 3: Rat Intestine Tissue Lysate at 50ug
Lane 4: Mouse Kidney Tissue Lysate at 50ug
Lane 5: Mouse Intestine Tissue Lysate at 50ug
Lane 6: Mouse Cardiac Muscle Tissue Lysate at 50ug
Lane 7: HEPG2 Whole Cell Lysate at 40ug
Lane 8: HELA Whole Cell Lysate at 40ug
Lane
Anti- MAOB antibody, ASA-B1214,IHC(P)
IHC(P): Mouse Intestine Tissue
IHC(P): Mouse Intestine Tissue
Anti- MAOB antibody, ASA-B1214,IHC(P)
IHC(P): Rat Intestine Tissue
IHC(P): Rat Intestine Tissue
