Description
Overview
Long Name |
Antibody Type |
Antibody Isotype |
Host |
Species Reactivity |
Validated Applications |
Purification |
| matrix metallopeptidase 9 (gelatinase B, 92kDa gelatinase, 92kDa type IV collagenase) | Polyclonal | IgG | Rabbit | Human | ELISA, WB | Immunogen affinity purified. |
Immunogen |
||||||
| A synthetic peptide corresponding to a sequence at the C-terminus of human MMP9 (633-667aa WRFDVKAQMVDPRSASEVDRMFPGVPLDTHDVFQY), different from the related mouse sequence by fourteen amino acids, and from the related rat sequence by sixteen amino acids. | ||||||
Properties
Form |
Lyophilized |
Size |
100 µg/vial |
Contents |
Antibody is lyophilized with 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg NaN3. *carrier free antibody available upon request. |
Concentration |
Reconstitute with 0.2 mL sterile dH2O (500 µg/ml final concentration). |
Storage |
At -20 °C for 12 months, as supplied. Store reconstituted antibody at 2-8 °C for one month. For long-term storage, aliquot and store at -20 °C. Avoid repeated freezing and thawing. |
Additional Information Regarding the Antigen
Gene |
MMP9 |
Protein |
Matrix metalloproteinase-9 |
Uniprot ID |
P14780 |
Function |
|
Tissue Specificity |
|
Sub-cellular localization |
|
Sequence Similarities |
|
Aliases |
82 kDa matrix metalloproteinase-9 antibody|92 kDa gelatinase antibody|92 kDa type IV collagenase antibody|CLG 4B antibody|CLG4B antibody| Collagenase Type 4 beta antibody| Collagenase type IV 92 KD antibody|EC 3.4.24.35 antibody|Gelatinase 92 KD antibody| Gelatinase B antibody|Gelatinase beta antibody|GelatinaseB antibody|GELB antibody| Macrophage gelatinase antibody|MANDP2 antibody| Matrix metallopeptidase 9 (gelatinase B, 92kDa gelatinase, 92kDa type IV collagenase) antibody|Matrix Metalloproteinase 9 antibody| MMP 9 antibody| MMP-9 antibody|MMP9 antibody|MMP9_HUMAN antibody|Type V collagenase antibody |
Application Details

Anti- MMP9 antibody, ASA-B1297, Western blotting
All lanes: Anti MMP9 (ASA-B1297) at 0.5ug/ml
WB: SW620 Whole Cell Lysate at 40ug
Predicted bind size: 67KD
Observed bind size: 67KD
All lanes: Anti MMP9 (ASA-B1297) at 0.5ug/ml
WB: SW620 Whole Cell Lysate at 40ug
Predicted bind size: 67KD
Observed bind size: 67KD





