Description
Overview
Long Name |
Antibody Type |
Antibody Isotype |
Host |
Species Reactivity |
Validated Applications |
Purification |
| NDRG family member 2 | Polyclonal | IgG | Rabbit | Human, Mouse, Rat | IHC-P, WB | Immunogen affinity purified. |
Immunogen |
||||||
| A synthetic peptide corresponding to a sequence at the C-terminus of human NDRG2 (210-247aa NSELIQKYRNIITHAPNLDNIELYWNSYNNRRDLNFER), different from the related mouse and rat sequences by three amino acids. | ||||||
Properties
Form |
Lyophilized |
Size |
100 µg/vial |
Contents |
Antibody is lyophilized with 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg NaN3. *carrier free antibody available upon request. |
Concentration |
Reconstitute with 0.2 mL sterile dH2O (500 µg/ml final concentration). |
Storage |
At -20 °C for 12 months, as supplied. Store reconstituted antibody at 2-8 °C for one month. For long-term storage, aliquot and store at -20 °C. Avoid repeated freezing and thawing. |
Additional Information Regarding the Antigen
Gene |
NDRG2 |
Protein |
Protein NDRG2 |
Uniprot ID |
Q9UN36 |
Function |
|
Tissue Specificity |
|
Sub-cellular localization |
|
Sequence Similarities |
|
Aliases |
Antidepressant related protein ADRG123 antibody|Cytoplasmic protein Ndr1 antibody|DKFZp781G1938 antibody|FLJ25522 antibody|KIAA1248 antibody|N myc downstream regulated gene 2 antibody|N myc downstream regulator 2 antibody|NDR1 related protein NDR2 antibody|NDRG 2 antibody|NDRG family member 2 antibody|NDRG1 related protein antibody|NDRG2 antibody|NDRG2_HUMAN antibody|Protein NDRG2 antibody|Protein Syld709613 antibody|SYLD antibody|Syld709613 protein antibody |
Application Details
Anti- NDRG2 antibody, ASA-B1354, Western blotting
All lanes: Anti NDRG2 (ASA-B1354) at 0.5ug/ml
Lane 1: Rat Brain Tissue Lysate at 50ug
Lane 2: Mouse Brain Tissue Lysate at 50ug
Predicted bind size: 41KD
Observed bind size: 41KD
All lanes: Anti NDRG2 (ASA-B1354) at 0.5ug/ml
Lane 1: Rat Brain Tissue Lysate at 50ug
Lane 2: Mouse Brain Tissue Lysate at 50ug
Predicted bind size: 41KD
Observed bind size: 41KD
Anti- NDRG2 antibody, ASA-B1354, IHC(P)
IHC(P): Mouse Brain Tissue
IHC(P): Mouse Brain Tissue
Anti- NDRG2 antibody, ASA-B1354, IHC(P)
IHC(P): Rat Brain Tissue
IHC(P): Rat Brain Tissue
