Description
Overview
Long Name |
Antibody Type |
Antibody Isotype |
Host |
Species Reactivity |
Validated Applications |
Purification |
| neuropeptide Y | Polyclonal | IgG | Rabbit | Human, Mouse, Rat | IHC-P, WB | Immunogen affinity purified. |
Immunogen |
||||||
| A synthetic peptide corresponding to a sequence in the middle region of human Neuropeptide Y (29-64aa YPSKPDNPGEDAPAEDMARYYSALRHYINLITRQRY), identical to the related mouse and rat sequences. | ||||||
Properties
Form |
Lyophilized |
Size |
100 µg/vial |
Contents |
Antibody is lyophilized with 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg NaN3. *carrier free antibody available upon request. |
Concentration |
Reconstitute with 0.2 mL sterile dH2O (500 µg/ml final concentration). |
Storage |
At -20 °C for 12 months, as supplied. Store reconstituted antibody at 2-8 °C for one month. For long-term storage, aliquot and store at -20 °C. Avoid repeated freezing and thawing. |
Additional Information Regarding the Antigen
Gene |
NPY |
Protein |
Pro-neuropeptide Y |
Uniprot ID |
P01303 |
Function |
NPY is implicated in the control of feeding and in secretion of gonadotrophin-release hormone. |
Tissue Specificity |
One of the most abundant peptides in the nervous system. Also found in some chromaffin cells of the adrenal medulla. |
Sub-cellular localization |
Secreted. |
Sequence Similarities |
Belongs to the NPY family. |
Aliases |
C-flanking peptide of NPY antibody|CPON antibody|Neuropeptide tyrosine antibody|Neuropeptide Y precursor antibody|NPY antibody|NPY_HUMAN antibody|Pro neuropeptide Y antibody|PYY 4 antibody|PYY4 antibody|Y Neuropeptide antibody |
Application Details
| Application | Concentration* | Species | Validated Using** |
| Western blot | 0.1-0.5μg/ml | Human | AssaySolutio’s ECL kit |
| Immunohistochemistry(Paraffin-embedded Section) | 0.5-1μg/ml | Mouse, Rat Human | AssaySolutio’s IHC/ICC Detection kit |
AssaySolution recommends Rabbit Chemiluminescent WB Detection Kit (AKIT001B) for Western blot, and Rabbit Peroxidase IHC/ICC Detection Kit (AKIT002B) for IHC(P). *Blocking peptide can be purchased at $65. Contact us for more information
Anti- Neuropeptide Y antibody, ASA-B1360, Western blotting
All lanes: Anti Neuropeptide Y (ASA-B1360) at 0.5ug/ml
WB: COLO320 Whole Cell Lysate at 40ug
Predicted bind size: 11KD
Observed bind size: 30KD
All lanes: Anti Neuropeptide Y (ASA-B1360) at 0.5ug/ml
WB: COLO320 Whole Cell Lysate at 40ug
Predicted bind size: 11KD
Observed bind size: 30KD
Anti- Neuropeptide Y antibody, ASA-B1360,IHC(P)
IHC(P): Mouse Brain Tissue
IHC(P): Mouse Brain Tissue
Anti- Neuropeptide Y antibody, ASA-B1360,IHC(P)
IHC(P): Rat Brain Tissue
IHC(P): Rat Brain Tissue
