p95 NBS1 Antibody

$365.00

In stock

SKU: ASA-B1468 Category:

Description

Overview

Long Name

Antibody Type

Antibody Isotype

Host

Species Reactivity

Validated Applications

Purification 

nibrin Polyclonal IgG Rabbit Human, Mouse, Rat IHC-P, WB Immunogen affinity purified.

Immunogen

A synthetic peptide corresponding to a sequence at the C-terminus of human p95 NBS1 (714-745aa RKNTELEEWLRQEMEVQNQHAKEESLADDLFR), different from the related mouse sequence by three amino acids, and from the related rat sequence by five amino acids.

Properties

Form

Lyophilized

Size

100 µg/vial

Contents

Antibody is lyophilized with 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg NaN3. *carrier free antibody available upon request.

Concentration

Reconstitute with 0.2 mL sterile dH2O (500 µg/ml final concentration).

Storage

At -20 °C for 12 months, as supplied. Store reconstituted antibody at 2-8 °C for one month. For long-term storage, aliquot and store at -20 °C. Avoid repeated freezing and thawing.

Additional Information Regarding the Antigen

Gene

NBN

Protein

Nibrin

Uniprot ID

O60934

Function

Component of the MRE11-RAD50-NBN (MRN complex) which plays a critical role in the cellular response to DNA damage and the maintenance of chromosome integrity. The complex is involved in double-strand break (DSB) repair, DNA recombination, maintenance of telomere integrity, cell cycle checkpoint control and meiosis. The complex possesses single-strand endonuclease activity and double-strand-specific 3′-5′ exonuclease activity, which are provided by MRE11A. RAD50 may be required to bind DNA ends and hold them in close proximity. NBN modulate the DNA damage signal sensing by recruiting PI3/PI4-kinase family members ATM, ATR, and probably DNA-PKcs to the DNA damage sites and activating their functions. It can also recruit MRE11 and RAD50 to the proximity of DSBs by an interaction with the histone H2AX. NBN also functions in telomere length maintenance by generating the 3′ overhang which serves as a primer for telomerase dependent telomere elongation. NBN is a major player in the control of intra-S-phase checkpoint and there is some evidence that NBN is involved in G1 and G2 checkpoints. The roles of NBS1/MRN encompass DNA damage sensor, signal transducer, and effector, which enable cells to maintain DNA integrity and genomic stability. Forms a complex with RBBP8 to link DNA double-strand break sensing to resection. Enhances AKT1 phosphorylation possibly by association with the mTORC2 complex.

Tissue Specificity

Ubiquitous. Expressed at high levels in testis.

Sub-cellular localization

Nucleus . Nucleus, PML body.

Sequence Similarities

Contains 1 BRCT domain.

Aliases

AT V1 antibody|AT V2 antibody|ATV antibody|ATV antibody|Cell cycle regulatory protein p95 antibody|FLJ10155 antibody|MGC87362 antibody| NBN antibody|NBN_HUMAN antibody|NBS 1 antibody|NBS antibody|NBS antibody|NBS1 antibody|Nibrin antibody|Nibrin antibody|Nijmegen breakage syndrome 1 (nibrin) antibody|Nijmegen breakage syndrome antibody|Nijmegen breakage syndrome protein 1 antibody|p95 antibody| p95 antibody|p95 protein of the MRE11/RAD50 complex antibody

Application Details

Application Concentration* Species Validated Using**
Western blot 0.1-0.5μg/ml Human, Mouse, Rat AssaySolutio’s ECL kit
Immunohistochemistry(Paraffin-embedded Section) 0.5-1μg/ml Human AssaySolutio’s IHC/ICC Detection kit

AssaySolution recommends Rabbit Chemiluminescent WB Detection Kit (AKIT001B) for Western blot, and Rabbit Peroxidase IHC/ICC Detection Kit (AKIT002B) for IHC(P). *Blocking peptide can be purchased at $65. Contact us for more information

Anti-p95 NBS1 antibody, ASA-B1468, Western blotting
All lanes: Anti p95 NBS1 (ASA-B1468) at 0.5ug/ml
Lane 1: Rat Testis Tissue Lysate at 50ug
Lane 2: Rat Brain Tissue Lysate at 50ug
Lane 3: Rat Liver Tissue Lysate at 50ug
Lane 4: Mouse Testis Tissue Lysate at 50ug
Lane 5: HELA Whole Cell Lysate at 40ug
Lane 6: A431 Whole Cell Lysate at 40ug
Lane 7: HUT Whole Cell Lysate at 40ug
Predicted bind size: 95KD
Observed bind size: 95KD
Anti-p95 NBS1 antibody, ASA-B1468, IHC(P)
IHC(P): Human Mammary Cancer Tissue