Description
Overview
Long Name |
Antibody Type |
Antibody Isotype |
Host |
Species Reactivity |
Validated Applications |
Purification |
| pyruvate kinase, liver and RBC | Polyclonal | IgG | Rabbit | Human, Mouse, Rat | IHC-P, WB | Immunogen affinity purified. |
Immunogen |
||||||
| A synthetic peptide corresponding to a sequence at the C-terminus of human PKLR (522-552aa EAIWADDVDRRVQFGIESGKLRGFLRVGDLV), different from the related mouse sequence by one amino acid, and identical to the rat sequence. | ||||||
Properties
Form |
Lyophilized |
Size |
100 µg/vial |
Contents |
Antibody is lyophilized with 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg NaN3. *carrier free antibody available upon request. |
Concentration |
Reconstitute with 0.2 mL sterile dH2O (500 µg/ml final concentration). |
Storage |
At -20 °C for 12 months, as supplied. Store reconstituted antibody at 2-8 °C for one month. For long-term storage, aliquot and store at -20 °C. Avoid repeated freezing and thawing. |
Additional Information Regarding the Antigen
Gene |
PKLR |
Protein |
Pyruvate kinase PKLR |
Uniprot ID |
P30613 |
Function |
Plays a key role in glycolysis. |
Tissue Specificity |
|
Sub-cellular localization |
|
Sequence Similarities |
Belongs to the pyruvate kinase family. |
Aliases |
EC 2.7.1.40 antibody|KPYR_HUMAN antibody|L-PK antibody|Pk-1 antibody|PK1 antibody|PKL antibody|Pklg antibody|Pklr antibody|PKR antibody|PKRL antibody| Pyruvate kinase 1 antibody|Pyruvate kinase isozymes R/L antibody|Pyruvate kinase liver and blood cell antibody|Pyruvate kinase liver and RBC antibody| Pyruvate kinase liver and red blood cell antibody|Pyruvate kinase liver type antibody|Pyruvate kinase type L antibody|Pyruvate kinase, red cell type antibody|R type/L type pyruvate kinase antibody|R-PK antibody|R-type/L-type pyruvate kinase antibody|Red cell/liver pyruvate kinase antibody|RPK antibody |
Application Details
| Application | Concentration* | Species | Validated Using** |
| Western blot | 0.1-0.5μg/ml | Mouse, Rat Human | AssaySolutio’s ECL kit |
| Immunohistochemistry(Paraffin-embedded Section) | 0.5-1μg/ml | Human Human | AssaySolutio’s IHC/ICC Detection kit |
AssaySolution recommends Rabbit Chemiluminescent WB Detection Kit (AKIT001B) for Western blot, and Rabbit Peroxidase IHC/ICC Detection Kit (AKIT002B) for IHC(P). *Blocking peptide can be purchased at $65. Contact us for more information
Anti-PKLR antibody, ASA-B1535, Western blotting
All lanes: Anti PKLR (ASA-B1535) at 0.5ug/ml
Lane 1: Rat Liver Tissue Lysate at 50ug
Lane 2: Mouse Liver Tissue Lysate at 50ug
Predicted bind size: 62KD
Observed bind size: 62KD
All lanes: Anti PKLR (ASA-B1535) at 0.5ug/ml
Lane 1: Rat Liver Tissue Lysate at 50ug
Lane 2: Mouse Liver Tissue Lysate at 50ug
Predicted bind size: 62KD
Observed bind size: 62KD
Anti-PKLR antibody, ASA-B1535, IHC(P)
IHC(P): Human Intestinal Cancer Tissue
IHC(P): Human Intestinal Cancer Tissue
