SLUG Antibody

$365.00

In stock

SKU: ASA-B1722 Category:

Description

Overview

Long Name

Antibody Type

Antibody Isotype

Host

Species Reactivity

Validated Applications

Purification 

snail family zinc finger 2 Polyclonal IgG Rabbit Human, Mouse, Rat IHC-P, WB Immunogen affinity purified.

Immunogen

A synthetic peptide corresponding to a sequence in the middle region of human SLUG (116-148aa KLSDPHAIEAEKFQCNLCNKTYSTFSGLAKHKQ), identical to the related mouse and rat sequences.

Properties

Form

Lyophilized

Size

100 µg/vial

Contents

Antibody is lyophilized with 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg NaN3. *carrier free antibody available upon request.

Concentration

Reconstitute with 0.2 mL sterile dH2O (500 µg/ml final concentration).

Storage

At -20 °C for 12 months, as supplied. Store reconstituted antibody at 2-8 °C for one month. For long-term storage, aliquot and store at -20 °C. Avoid repeated freezing and thawing.

Additional Information Regarding the Antigen

Gene

SNAI2

Protein

Zinc finger protein SNAI2

Uniprot ID

O43623

Function

Transcriptional repressor that modulates both activator- dependent and basal transcription. Involved in the generation and migration of neural crest cells. Plays a role in mediating RAF1- induced transcriptional repression of the TJ protein, occludin (OCLN) and subsequent oncogenic transformation of epithelial cells (By similarity). Represses BRCA2 expression by binding to its E2- box-containing silencer and recruiting CTBP1 and HDAC1 in breast cells. In epidermal keratinocytes, binds to the E-box in ITGA3 promoter and represses its transcription. Involved in the regulation of ITGB1 and ITGB4 expression and cell adhesion and proliferation in epidermal keratinocytes. Binds to E-box2 domain of BSG and activates its expression during TGFB1-induced epithelial-mesenchymal transition (EMT) in hepatocytes. Represses E-Cadherin/CDH1 transcription via E-box elements. Involved in osteoblast maturation. Binds to RUNX2 and SOC9 promoters and may act as a positive and negative transcription regulator, respectively, in osteoblasts. Binds to CXCL12 promoter via E-box regions in mesenchymal stem cells and osteoblasts. Plays an essential role in TWIST1-induced EMT and its ability to promote invasion and metastasis.

Tissue Specificity

Expressed in most adult human tissues, including spleen, thymus, prostate, testis, ovary, small intestine, colon, heart, brain, placenta, lung, liver, skeletal muscle, kidney and pancreas. Not detected in peripheral blood leukocyte. Expressed in the dermis and in all layers of the epidermis, with high levels of expression in the basal layers (at protein level). Expressed in osteoblasts (at protein level). Expressed in mesenchymal stem cells (at protein level). Expressed in breast tumor cells (at protein level).

Sub-cellular localization

Nucleus. Cytoplasm. Note: Observed in discrete foci in interphase nuclei. These nuclear foci do not overlap with the nucleoli, the SP100 and the HP1 heterochromatin or the coiled body, suggesting SNAI2 is associated with active transcription or active splicing regions.

Sequence Similarities

Belongs to the snail C2H2-type zinc-finger protein family.

Aliases

MGC10182 antibody|Neural crest transcription factor Slug antibody|Protein snail homolog 2 antibody|Slug (chicken homolog) zinc finger protein antibody|Slug homolog zinc finger protein antibody|Slug zinc finger protein antibody|SLUGH 1 antibody|SLUGH antibody|SLUGH1 antibody|SNAI 2 antibody|SNAI2 antibody| SNAI2_HUMAN antibody|Snail 2 antibody|Snail homolog 2 antibody|Snail2 antibody|WS 2D antibody|WS2D antibody|Zinc finger protein SLUG antibody| Zinc finger protein SNAI2 antibody

Application Details

Application Concentration* Species Validated Using**
Western blot 0.1-0.5μg/ml Human, Mouse AssaySolutio’s ECL kit
Immunohistochemistry(Paraffin-embedded Section) 0.5-1μg/ml Mouse, Rat Human AssaySolutio’s IHC/ICC Detection kit

AssaySolution recommends Rabbit Chemiluminescent WB Detection Kit (AKIT001B) for Western blot, and Rabbit Peroxidase IHC/ICC Detection Kit (AKIT002B) for IHC(P). *Blocking peptide can be purchased at $65. Contact us for more information

Anti- SLUG antibody, ASA-B1722, Western blotting
All lanes: Anti SLUG (ASA-B1722) at 0.5ug/ml
Lane 1: Mosue Kidney Tissue Lysate at 50ug
Lane 2: Mouse Lung Tissue Lysate at 50ug
Lane 3: Mouse Spleen Tissue Lysate at 50ug
Lane 4: Mouse Brain Tissue Lysate at 50ug
Lane 5: MCF-7 Whole Cell Lysate at 40ug
Predicted bind size: 30KD
Observed bind size: 39KD
Anti- SLUG antibody, ASA-B1722,IHC(P)
IHC(P): Mouse Cardiac Muscle Tissue
Anti- SLUG antibody, ASA-B1722,IHC(P)
IHC(P): Rat Cardiac Muscle Tissue