Description
Overview
Long Name |
Antibody Type |
Antibody Isotype |
Host |
Species Reactivity |
Validated Applications |
Purification |
| signal transducer and activator of transcription 1, 91kDa | Polyclonal | IgG | Rabbit | Human, Mouse, Rat | IHC-P, WB | Immunogen affinity purified. |
Immunogen |
||||||
| A synthetic peptide corresponding to a sequence at the N-terminus of human STAT1 (114-143aa KILENAQRFNQAQSGNIQSTVMLDKQKELD), different from the related mouse sequence by two amino acids. | ||||||
Properties
Form |
Lyophilized |
Size |
100 µg/vial |
Contents |
Antibody is lyophilized with 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg NaN3. *carrier free antibody available upon request. |
Concentration |
Reconstitute with 0.2 mL sterile dH2O (500 µg/ml final concentration). |
Storage |
At -20 °C for 12 months, as supplied. Store reconstituted antibody at 2-8 °C for one month. For long-term storage, aliquot and store at -20 °C. Avoid repeated freezing and thawing. |
Additional Information Regarding the Antigen
Gene |
STAT1 |
Protein |
Signal transducer and activator of transcription 1-alpha/beta |
Uniprot ID |
P42224 |
Function |
Signal transducer and transcription activator that mediates cellular responses to interferons (IFNs), cytokine KITLG/SCF and other cytokines and other growth factors. Following type I IFN (IFN-alpha and IFN-beta) binding to cell surface receptors, signaling via protein kinases leads to activation of Jak kinases (TYK2 and JAK1) and to tyrosine phosphorylation of STAT1 and STAT2. The phosphorylated STATs dimerize and associate with ISGF3G/IRF-9 to form a complex termed ISGF3 transcription factor, that enters the nucleus. ISGF3 binds to the IFN stimulated response element (ISRE) to activate the transcription of IFN- stimulated genes (ISG), which drive the cell in an antiviral state. In response to type II IFN (IFN-gamma), STAT1 is tyrosine- and serine-phosphorylated. It then forms a homodimer termed IFN- gamma-activated factor (GAF), migrates into the nucleus and binds to the IFN gamma activated sequence (GAS) to drive the expression of the target genes, inducing a cellular antiviral state. Becomes activated in response to KITLG/SCF and KIT signaling. May mediate cellular responses to activated FGFR1, FGFR2, FGFR3 and FGFR4. |
Tissue Specificity |
|
Sub-cellular localization |
Cytoplasm. |
Sequence Similarities |
Belongs to the transcription factor STAT family. |
Aliases |
Signal transducer and activator of transcription 1 91kD antibody| DKFZp686B04100 antibody| ISGF 3 antibody|ISGF-3 antibody| OTTHUMP00000163552 antibody|OTTHUMP00000165046 antibody| OTTHUMP00000165047 antibody|OTTHUMP00000205845 antibody|Signal transducer and activator of transcription 1 91kDa antibody|Signal transducer and activator of transcription 1 alpha/ beta antibody|Signal transducer and activator of transcription 1 antibody|Signal transducer and activator of transcription 1, 91kD antibody|Signal transducer and activator of transcription 1-alpha/beta antibody|Signal Transductor and Activator of Transcription 1 antibody|STAT 1 antibody|STAT 91 antibody|Stat1 antibody|STAT1_HUMAN antibody|STAT91 antibody|Transcription factor ISGF 3 components p91 p84 antibody|Transcription factor ISGF-3 components p91/p84 antibody |
Application Details
| Application | Concentration* | Species | Validated Using** |
| Western blot | 0.1-0.5μg/ml | Human, Rat | AssaySolutio’s ECL kit |
| Immunohistochemistry(Paraffin-embedded Section) | 0.5-1μg/ml | Human, Mouse, Rat | AssaySolutio’s IHC/ICC Detection kit |
AssaySolution recommends Rabbit Chemiluminescent WB Detection Kit (AKIT001B) for Western blot, and Rabbit Peroxidase IHC/ICC Detection Kit (AKIT002B) for IHC(P). *Blocking peptide can be purchased at $65. Contact us for more information

Anti- STAT1 antibody, ASA-B1791, Western blotting
All lanes: Anti STAT1 (ASA-B1791) at 0.5ug/ml
Lane 1: Rat Testis Tissue Lysate at 50ug
Lane 2: Rat Brain Tissue Lysate at 50ug
Lane 3: Rat Liver Tissue Lysate at 50ug
Lane 4: Human Placenta Tissue Lysate at 50ug
Lane 5: MCF-7 Whole Cell Lysate at 40ug
Lane 6: SW620 Whole Cell Lysate at 40ug
Predicted bind size: 91KD(Alpha), 84KD(Beta )
Observed bind size: 91KD(Alpha), 84KD(Beta )
All lanes: Anti STAT1 (ASA-B1791) at 0.5ug/ml
Lane 1: Rat Testis Tissue Lysate at 50ug
Lane 2: Rat Brain Tissue Lysate at 50ug
Lane 3: Rat Liver Tissue Lysate at 50ug
Lane 4: Human Placenta Tissue Lysate at 50ug
Lane 5: MCF-7 Whole Cell Lysate at 40ug
Lane 6: SW620 Whole Cell Lysate at 40ug
Predicted bind size: 91KD(Alpha), 84KD(Beta )
Observed bind size: 91KD(Alpha), 84KD(Beta )

Anti- STAT1 antibody, ASA-B1791, IHC(P)
IHC(P): Mouse Intestine Tissue
IHC(P): Mouse Intestine Tissue

Anti- STAT1 antibody, ASA-B1791, IHC(P)
IHC(P): Rat Intestine Tissue
IHC(P): Rat Intestine Tissue




