Description
Overview
Long Name |
Antibody Type |
Antibody Isotype |
Host |
Species Reactivity |
Validated Applications |
Purification |
| signal transducer and activator of transcription 6, interleukin-4 induced | Polyclonal | IgG | Rabbit | Human, Rat | WB | Immunogen affinity purified. |
Immunogen |
||||||
| A synthetic peptide corresponding to a sequence at the N-terminus of human STAT6(85-115aa ESIYQRDPLKLVATFRQILQGEKKAVMEQFR), different from the related mouse sequence by three amino acids. | ||||||
Properties
Form |
Lyophilized |
Size |
100 µg/vial |
Contents |
Antibody is lyophilized with 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg NaN3. *carrier free antibody available upon request. |
Concentration |
Reconstitute with 0.2 mL sterile dH2O (500 µg/ml final concentration). |
Storage |
At -20 °C for 12 months, as supplied. Store reconstituted antibody at 2-8 °C for one month. For long-term storage, aliquot and store at -20 °C. Avoid repeated freezing and thawing. |
Additional Information Regarding the Antigen
Gene |
STAT6 |
Protein |
Signal transducer and activator of transcription 6 |
Uniprot ID |
P42226 |
Function |
Carries out a dual function: signal transduction and activation of transcription. Involved in IL4/interleukin-4- and IL3/interleukin-3-mediated signaling. |
Tissue Specificity |
|
Sub-cellular localization |
Cytoplasm. Nucleus. Note: Translocated into the nucleus in response to phosphorylation. |
Sequence Similarities |
Belongs to the transcription factor STAT family. |
Aliases |
D12S1644 antibody|IL 4 STAT antibody|IL-4 Stat antibody|IL4 STAT antibody| Interleukin 4 Induced antibody|Interleukin 4 Induced Transcription Factor IL4 STAT antibody|Signal transducer and activator of transcription 6 antibody|Signal Transducer And Activator Of Transcription 6 Interleukin 4 Induced antibody|Signal Transducer And Activator Of Transcription 6 Nirs Variant 1 antibody|Signal transducer and activator of transcription 6, interleukin 4 induced antibody|STAT 6 antibody|STAT interleukin4 induced antibody|STAT, interleukin4 induced antibody| Stat6 antibody|STAT6_HUMAN antibody|STAT6B antibody|STAT6C antibody| Transcription factor IL 4 STAT antibody |
Application Details
| Application | Concentration* | Species | Validated Using** |
| Western blot | 0.1-0.5μg/ml | Rat Human | AssaySolutio’s ECL kit |
AssaySolution recommends Rabbit Chemiluminescent WB Detection Kit (AKIT001B) for Western blot. *Blocking peptide can be purchased at $65. Contact us for more information

Anti- STAT6 antibody, ASA-B1802, Western blotting
All lanes: Anti STAT6 (ASA-B1802) at 0.5ug/ml
WB: Rat Brain Tissue Lysate at 50ug
Predicted bind size: 94KD
Observed bind size: 94KD
All lanes: Anti STAT6 (ASA-B1802) at 0.5ug/ml
WB: Rat Brain Tissue Lysate at 50ug
Predicted bind size: 94KD
Observed bind size: 94KD





