Description
Overview
Long Name |
Antibody Type |
Antibody Isotype |
Host |
Species Reactivity |
Validated Applications |
Purification |
| stathmin 1 | Polyclonal | IgG | Rabbit | Human, Mouse, Rat | IHC-P, WB | Immunogen affinity purified. |
Immunogen |
||||||
| A synthetic peptide corresponding to a sequence at the N-terminus of human Stathmin 1 (2-34aa ASSDIQVKELEKRASGQAFELILSPRSKESVPE), different from the related mouse sequence by one amino acid, and identical to the related rat sequence. | ||||||
Properties
Form |
Lyophilized |
Size |
100 µg/vial |
Contents |
Antibody is lyophilized with 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg NaN3. *carrier free antibody available upon request. |
Concentration |
Reconstitute with 0.2 mL sterile dH2O (500 µg/ml final concentration). |
Storage |
At -20 °C for 12 months, as supplied. Store reconstituted antibody at 2-8 °C for one month. For long-term storage, aliquot and store at -20 °C. Avoid repeated freezing and thawing. |
Additional Information Regarding the Antigen
Gene |
STMN1 |
Protein |
Stathmin |
Uniprot ID |
P16949 |
Function |
Involved in the regulation of the microtubule (MT) filament system by destabilizing microtubules. Prevents assembly and promotes disassembly of microtubules. Phosphorylation at Ser- 16 may be required for axon formation during neurogenesis. Involved in the control of the learned and innate fear (By similarity). |
Tissue Specificity |
Ubiquitous. Expression is strongest in fetal and adult brain, spinal cord, and cerebellum, followed by thymus, bone marrow, testis, and fetal liver. Expression is intermediate in colon, ovary, placenta, uterus, and trachea, and is readily detected at substantially lower levels in all other tissues examined. Lowest expression is found in adult liver. Present in much greater abundance in cells from patients with acute leukemia of different subtypes than in normal peripheral blood lymphocytes, non-leukemic proliferating lymphoid cells, bone marrow cells, or cells from patients with chronic lymphoid or myeloid leukemia. |
Sub-cellular localization |
Cytoplasm, cytoskeleton. |
Sequence Similarities |
Belongs to the stathmin family. |
Aliases |
C1orf215 antibody|Lag antibody|LAP 18 antibody|LAP18 antibody|Leukemia associated phosphoprotein p18 antibody|Leukemia-associated phosphoprotein p18 antibody|Metablastin antibody|Oncoprotein 18 antibody|OP 18 antibody|OP18 antibody|p18 antibody|p19 antibody| Phosphoprotein 19 antibody|Phosphoprotein p19 antibody|PP17 antibody|PP19 antibody|PR22 antibody|Pr22 protein antibody| Prosolin antibody|Protein Pr22 antibody|SMN antibody| Stathmin antibody| Stathmin1 antibody|Stathmin-1 antibody|STMN 1 antibody|STMN1 antibody|STMN1_HUMAN antibody |
Application Details
| Application | Concentration* | Species | Validated Using** |
| Western blot | 0.1-0.5μg/ml | Human, Mouse | AssaySolutio’s ECL kit |
| Immunohistochemistry(Paraffin-embedded Section) | 0.5-1μg/ml | Human, Mouse, Rat | AssaySolutio’s IHC/ICC Detection kit |
AssaySolution recommends Rabbit Chemiluminescent WB Detection Kit (AKIT001B) for Western blot, and Rabbit Peroxidase IHC/ICC Detection Kit (AKIT002B) for IHC(P). *Blocking peptide can be purchased at $65. Contact us for more information

Anti- Stathmin 1 antibody, ASA-B1803, Western blotting
All lanes: Anti Stathmin 1 (ASA-B1803) at 0.5ug/ml
Lane 1: Mouse Brain Tissue Lysate at 50ug
Lane 2: Mouse Testis Tissue Lysate at 50ug
Lane 3: MM231 Whole Cell Lysate at 40ug
Lane 4: MCF-7 Whole Cell Lysate at 40ug
Predicted bind size: 17KD
Observed bind size: 17KD
All lanes: Anti Stathmin 1 (ASA-B1803) at 0.5ug/ml
Lane 1: Mouse Brain Tissue Lysate at 50ug
Lane 2: Mouse Testis Tissue Lysate at 50ug
Lane 3: MM231 Whole Cell Lysate at 40ug
Lane 4: MCF-7 Whole Cell Lysate at 40ug
Predicted bind size: 17KD
Observed bind size: 17KD

nti- Stathmin 1 antibody, ASA-B1803, IHC(P)
IHC(P): Mouse Testis Tissue
IHC(P): Mouse Testis Tissue

nti- Stathmin 1 antibody, ASA-B1803, IHC(P)
IHC(P): Rat Brain Tissue
IHC(P): Rat Brain Tissue




