Description
Overview
Long Name |
Antibody Type |
Antibody Isotype |
Host |
Species Reactivity |
Validated Applications |
Purification |
| TNF receptor-associated factor 6, E3 ubiquitin protein ligase | Polyclonal | IgG | Rabbit | Human, Mouse, Rat | WB | Immunogen affinity purified. |
Immunogen |
||||||
| A synthetic peptide corresponding to a sequence at the N-terminus of human TRAF6 (99-130aa RDAGHKCPVDNEILLENQLFPDNFAKREILSL), identical to the related mouse and rat sequences. | ||||||
Properties
Form |
Lyophilized |
Size |
100 µg/vial |
Contents |
Antibody is lyophilized with 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg NaN3. *carrier free antibody available upon request. |
Concentration |
Reconstitute with 0.2 mL sterile dH2O (500 µg/ml final concentration). |
Storage |
At -20 °C for 12 months, as supplied. Store reconstituted antibody at 2-8 °C for one month. For long-term storage, aliquot and store at -20 °C. Avoid repeated freezing and thawing. |
Additional Information Regarding the Antigen
Gene |
TRAF6 |
Protein |
TNF receptor-associated factor 6 |
Uniprot ID |
Q9Y4K3 |
Function |
E3 ubiquitin ligase that, together with UBE2N and UBE2V1, mediates the synthesis of ‘Lys-63’-linked-polyubiquitin chains conjugated to proteins, such as IKBKG, IRAK1, AKT1 and AKT2. Also mediates ubiquitination of free/unanchored polyubiquitin chain that leads to MAP3K7 activation. Leads to the activation of NF-kappa-B and JUN. May be essential for the formation of functional osteoclasts. Seems to also play a role in dendritic cells (DCs) maturation and/or activation. Represses c- Myb-mediated transactivation, in B-lymphocytes. Adapter protein that seems to play a role in signal transduction initiated via TNF receptor, IL-1 receptor and IL-17 receptor. Regulates osteoclast differentiation by mediating the activation of adapter protein complex 1 (AP-1) and NF-kappa-B, in response to RANK-L stimulation. Together with MAP3K8, mediates CD40 signals that activate ERK in B-cells and macrophages, and thus may play a role in the regulation of immunoglobulin production. |
Tissue Specificity |
Expressed in heart, brain, placenta, lung, liver, skeletal muscle, kidney and pancreas. |
Sub-cellular localization |
Cytoplasm. |
Sequence Similarities |
Belongs to the TNF receptor-associated factor family. A subfamily. |
Aliases |
E3 ubiquitin-protein ligase TRAF6 antibody|Interleukin 1 signal transducer antibody|Interleukin-1 signal transducer antibody|MGC 3310 antibody|MGC:3310 antibody|MGC3310 antibody|OTTHUMP00000232772 antibody| OTTHUMP00000232773 antibody|RING finger protein 85 antibody|RNF 85 antibody|RNF85 antibody|TNF receptor associated factor 6 antibody|TNF receptor-associated factor 6 antibody|TRAF 6 antibody|Traf6 antibody|TRAF6_HUMAN antibody |
Application Details
| Application | Concentration* | Species | Validated Using** |
| Western blot | 0.1-0.5μg/ml | Human, Mouse, Rat | AssaySolutio’s ECL kit |
AssaySolution recommends Rabbit Chemiluminescent WB Detection Kit (AKIT001B) for Western blot. *Blocking peptide can be purchased at $65. Contact us for more information

Anti- TRAF6 antibody, ASA-B1907, Western blotting
All lanes: Anti (PB) at 0.5ug/ml
Lane 1: Rat Brain Tissue Lysate at 50ug
Lane 2: Rat Skeletal Muscle Tissue Lysate at 50ug
Lane 3: Mouse Brain Tissue Lysate at 50ug
Lane 4: PANC Whole Cell Lysate at 40ug
Lane 5: A549 Whole Cell Lysate at 40ug
Lane 6: HELA Whole Cell Lysate at 40ug
Lane 7: SMMC Whole Cell Lysate at 40ug
Predicted bind size: 80KD
Observed bind size: 80KD
All lanes: Anti (PB) at 0.5ug/ml
Lane 1: Rat Brain Tissue Lysate at 50ug
Lane 2: Rat Skeletal Muscle Tissue Lysate at 50ug
Lane 3: Mouse Brain Tissue Lysate at 50ug
Lane 4: PANC Whole Cell Lysate at 40ug
Lane 5: A549 Whole Cell Lysate at 40ug
Lane 6: HELA Whole Cell Lysate at 40ug
Lane 7: SMMC Whole Cell Lysate at 40ug
Predicted bind size: 80KD
Observed bind size: 80KD





